제품 상세 Antibody 6.5 - 270 kDa 범위를 커버하는 3가지 컬러 밴드를 포함하며, 최대 100%까지의 transfer 효과를 개런티하는 Prestained protein ladder를 소개합니다. 프린트 제품 문의 주요제품 anti-ZNF264 antibody (#ARG41259) Product Description Rabbit Polyclonal antibody recognizes ZNF264 Tested Reactivity Hu Predict Reactivity Cow, Rat, Dog, Hrs, Rb Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name ZNF264 Antigen Species Human Immunogen Synthetic peptide around the C-terminal region of Human ZNF264. (within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL) Conjugation Un-conjugated Alternate Names Zinc finger protein 264 anti-ZNF281 antibody (#ARG55027) Product Description Rabbit Polyclonal antibody recognizes ZNF281 Tested Reactivity Hu, Ms Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name ZNF281 Antigen Species Human Immunogen KLH-conjugated synthetic peptide corresponding to aa. 416-450 (Center) of Human ZNF281. Conjugation Un-conjugated Alternate Names ZBP-99; GC-box-binding zinc finger protein 1; Transcription factor ZBP-99; Zinc finger protein 281; ZNP-99; Zinc finger DNA-binding protein 99 주문정보 견적문의 제품담기 주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다. Product Cat.No. Size Maker Qty Data Sheet MSDS 전체보기 추천제품 관련제품 견적문의 제품담기 주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다. Product Cat.No. Size Maker Qty Data Sheet MSDS 전체보기 자료 웨비나/Video