제품 상세 Antibody 6.5 - 270 kDa 범위를 커버하는 3가지 컬러 밴드를 포함하며, 최대 100%까지의 transfer 효과를 개런티하는 Prestained protein ladder를 소개합니다. 프린트 제품 문의 주요 제품Anti-Angiopoietin 1 antibody (#ARG41882)Product Description : Rabbit Polyclonal antibody recognizes Angiopoietin 1Tested Reactivity : Hu, Ms, RatTested Application : IHC-PHost : RabbitClonality : PolyclonalIsotype : IgGTarget Name : Angiopoietin 1Antigen Species : HumanImmunogen : Recombinant fusion protein corresponding to aa. 260-400 of Human Angiopoietin 1. (NP_001186788.1)Anti-Angiopoietin 2 antibody (#ARG55289)Product Description : Rabbit Polyclonal antibody recognizes Angiopoietin 2Tested Reactivity : HuTested Application : ICC/IF, WBHost : RabbitClonality : PolyclonalIsotype : IgGTarget Name : Angiopoietin 2Antigen Species : HumanImmunogen : Recombinant protein of Human ANGPT2 Anti-Angiopoietin 4 antibody (#ARG43265) Product Description : Rabbit Polyclonal antibody recognizes Angiopoietin 4Tested Reactivity : HuTested Application : IHC-P, WBHost : RabbitClonality : PolyclonalIsotype : IgGTarget Name : Angiopoietin 4Antigen Species : HumanImmunogen : Synthetic peptide derived from Human Angiopoietin 4. Anti-ANGPTL2 antibody (#ARG59313) Product Description : Rabbit Polyclonal antibody recognizes ANGPTL2Tested Reactivity : Hu, Ms, RatTested Application : IHC-P, WBHost : RabbitClonality : PolyclonalIsotype : IgGTarget Name : ANGPTL2Antigen Species : HumanImmunogen : Synthetic peptide corresponding to aa. 275-312 of Human ANGPTL2. (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) 주문정보 견적문의 제품담기 주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다. Product Cat.No. Size Maker Qty Data Sheet MSDS 전체보기 추천제품 관련제품 견적문의 제품담기 주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다. Product Cat.No. Size Maker Qty Data Sheet MSDS 전체보기 자료 웨비나/Video