고마바이오텍(주)
Category 전체보기
전기영동 > 단백질 전기영동 전기영동 > 헥산 전기영동
Cat. No.전체보기

검색 결과가 없습니다.

Product전체보기

검색 결과가 없습니다.

Brand전체보기

검색 결과가 없습니다.

제품 상세

Antibody

6.5 - 270 kDa 범위를 커버하는 3가지 컬러 밴드를 포함하며,
최대 100%까지의 transfer 효과를 개런티하는 Prestained protein ladder를 소개합니다.

주요 제품 

 

anti-Transferrin antibody [HTF-14] (low endotoxin) (#ARG65462)
Product Description Azide free and low endotoxin Mouse Monoclonal antibody [HTF-14] recognizes Transferrin
Tested Reactivity Hu, Pig, Rb
Species Does Not React With Cow, Dog, Hrs, Sheep
Tested Application ELISA, FuncSt, ICC/IF, IHC-P, RIA, WB
Specificity The antibody HTF-14 recognizes an epitope located in the N-terminal domain of human serum transferrin, a 77 kDa single polypeptide chain glycoprotein (member of the iron binding family of proteins). It is synthesised in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+.
Host Mouse
Clonality Monoclonal
Clone HTF-14
Isotype IgG1
Target Name Transferrin
Antigen Species Pig
Immunogen Purified porcine transferrin.
Conjugation Un-conjugated
Alternate Names Beta-1 metal-binding globulin; Siderophilin; Transferrin; PRO1557; TFQTL1; Serotransferrin; PRO2086
     
anti-Transferrin antibody (#ARG41090)
Product Description Rabbit Polyclonal antibody recognizes Transferrin
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Transferrin
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 20-49 of Human Transferrin. (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI)
Conjugation Un-conjugated
Alternate Names Beta-1 metal-binding globulin; Siderophilin; Transferrin; PRO1557; TFQTL1; Serotransferrin; PRO2086
     
  anti-Transferrin antibody (#ARG66294)
Product Description Mouse Monoclonal antibody recognizes Transferrin
Tested Reactivity Hu
Tested Application ICC/IF, IHC-P, WB
Specificity The antibody detects endogenous Human Transferrin protein.
Host Mouse
Clonality Monoclonal
Isotype IgG
Target Name Transferrin
Antigen Species Human
Immunogen Synthetic peptide of Human Transferrin.
Conjugation Un-conjugated
Alternate Names Beta-1 metal-binding globulin; Siderophilin; Transferrin; PRO1557; TFQTL1; Serotransferrin; PRO2086
     
  anti-CD71 / Transferrin Receptor antibody (#ARG41769)
Product Description Rabbit Polyclonal antibody recognizes CD71 / Transferrin Receptor
Tested Reactivity Hu
Tested Application FACS, ICC/IF, IHC-Fr, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CD71 / Transferrin Receptor
Antigen Species Human
Immunogen Recombinant protein corresponding to M1-N198 of Human CD71 / Transferrin Receptor.
Conjugation Un-conjugated
Alternate Names TFR1; CD antigen CD71; CD71; T9; p90; TR; Trfr; Transferrin receptor protein 1; TRFR; sTfR; TfR1; TfR; TFR

 

 

 

 

  

 




  

  

 

주문정보

주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다.
  Product Cat.No. Size Maker Qty Data Sheet MSDS
전체보기

추천제품

자료

웨비나/Video

TOP

제품 문의

0.5 ml Elite Pre-stained Protein Ladder (2 x 0.25 ml) PAL-EPL-500 0.5ml 500
Maker
Cat.No.
Product
Size
Qty
Data Sheet
MSDS

로그인

로그인