제품 상세 Antibody 6.5 - 270 kDa 범위를 커버하는 3가지 컬러 밴드를 포함하며, 최대 100%까지의 transfer 효과를 개런티하는 Prestained protein ladder를 소개합니다. 프린트 제품 문의 주요 제품 Recombinant human BDNF protein (#B-250) Origin Recombinant, E. coli MW 27 kDa Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR. Peptide Content 100% Purity >98% (HPLC) Form Lyophilized from a 0.2 µm filtered solution. Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method. Effective concentration ED50 = 220 pM. Biological Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors. BDNF supports the survival of many cell types. Recombinant human proBDNF protein (#B-257) Origin Recombinant, E. coli MW 51.78 kDa Sequence MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (shown in bold is the prodomain). Peptide Content 100% Purity >98% (HPLC) Form Lyophilized from a 0.2 µm filtered solution. Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method. Effective concentration 0.1-10 nM Biological Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons expressing both p75 and sortilin, and to be involved in LTD. Native mouse NGF 2.5S protein (>95%) (#N-100) Origin Native protein isolated from mouse submaxillary glands. MW 26 kDa Peptide Content 100% Purity >95% (HPLC) Form Lyophilized from a 0.2 µm filtered solution. Effective concentration EC50 = 0.7 nM. Biological Activity NGF is purified in three forms: the 7S, 2.5S and β. The 2.5S form is 9 amino acids shorter than the β form because of proteolysis that occurs during the purification process. NGF has been shown to regulate neuronal survival, development, function and plasticity. The biological effects of NGF are mediated by two receptors: TrkA, which is specific for NGF, and p75NTR, which binds all the neurotrophins. Native mouse NGF 7S protein(#N-130) Origin Native protein isolated from mouse submaxillary glands. MW 130 kDa Peptide Content 100% Purity >98% (HPLC) Form Lyophilized from a 0.2 µm filtered solution Effective concentration EC50 = 0.2 nM Biological Activity NGF is purified in three forms: the 7S, 2.5S and β. The 7S 130 kDa form occurs naturally in mouse submaxillary glands and is a multimeric protein composed of two α, one β and two γ subunits. The biologically active subunit is the β, which is a 26 kDa dimer composed of two identical chains held together by hydrophobic interactions. The α chain stabilizes the 7S complex and binds two zinc ions per 7S complex as a cofactor at the β-γ interface. The γ chain is an arginine specific protease, it may also have plasminongen activator activity as well as mitogenic activity for chick embryo fibroblasts. Anti-BDNF Antibody (#ANT-010) Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor) (Accession P23560). Homology Mouse, rat and many other species - identical. Purity Affinity purified on immobilized antigen. Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3. Specificity The antibody is specific for BDNF; it does not crossreact with NGF, NT-3 or NT-4. Peptide Confirmation Confirmed by amino acid analysis and mass spectrometry. Application Western blot, Immunocytochemistry, Immunohistochemistry 주문정보 견적문의 제품담기 주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다. Product Cat.No. Size Maker Qty Data Sheet MSDS 전체보기 추천제품 관련제품 견적문의 제품담기 주문정보 - Cat No, PRODUCT, SIZE, 수량 등 항목으로 구성되어있습니다. Product Cat.No. Size Maker Qty Data Sheet MSDS 전체보기 자료 웨비나/Video